Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANO5 Protein

This Human ANO5 Protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Gnathodiaphyseal dysplasia 1 protein) (Transmembrane protein 16E)

UniProt

Q75V66

Expression Region

1-299aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGDPDLLEVLAEEGEKVNKHIDYSFQMSEQSLSSRETSFLINEETMPAKRFNLFLRRRLMFQKNQQSKDSIFFRDGIRQIDFVLSYVDDVKKDAELKAERRKEFETNLRKTGLELEIEDKRDSEDGRTYFVKIHAPWEVLVTYAEVLGIKMPIKESDIPRPKHTPISYVLGPVRLPLSVKYPHPEYFTAQFSRHRQELFLIEDQATFFPSSSRNRIVYYILSRCPFGIEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Domestic Spherical C18, 20-40μm, 100Å, 4g
12013009 20 Pieces

Domestic Spherical C18, 20-40μm, 100Å, 4g

Sign In for Pricing
View Details
Human AREG Protein
PRP1075-01 5 µg

Human AREG Protein

Sign In for Pricing
View Details
Human AREG Protein
PRP1075-02 20 µg

Human AREG Protein

Sign In for Pricing
View Details
Human AREG Protein
PRP1075-03 100 µg

Human AREG Protein

Sign In for Pricing
View Details
Human AREG Protein
PRP1075-04 1 mg

Human AREG Protein

Sign In for Pricing
View Details
HBZ (C-Term) Rabbit pAb
MBS8553533-01 0.1 mL

HBZ (C-Term) Rabbit pAb

Sign In for Pricing
View Details