Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPO Protein

Recombinant of Human TPO protein

Product Specifications

Product Name Alternative

Megakaryocyte colony-stimulating factor, Myeloproliferative leukemia virus oncogene ligand, C-mpl ligand, ML, Megakaryocyte growth and development factor, MGDF, TPO, MKCSF, MPLLG, MGC163194, THPO.

Source

HEK

Purity

Greater than 95% as obsereved by SDS-PAGE.

Bioactivity

The activity was determined by the dose-dependent stimulation of the proliferation of MO7e cells, the ED50 is 1.15ng/ml.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Thrombopoietin in sterile PBS containing 0.1% endotoxin-free recombinant HSA.

Storage Conditions

Stability: Lyophilized Thrombopoietin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TPO should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Cytokines And Growth Factors

Preservative

The TPO protein was filtered (0.2μm) and lyophilized from 0.74mg/ml in 1xPBS.

AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQV RLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGG STLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK WQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAP DISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPT PTSPLLNTSYTHSQNLSQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 430 Anti-human CD87 Antibody *VIM5*
10870031-AAT 500 Tests

IFluor® 430 Anti-human CD87 Antibody *VIM5*

Sign In for Pricing
View Details
Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)
RPC31110-01 20 µg

Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)

Sign In for Pricing
View Details
Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)
RPC31110-02 100 µg

Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)

Sign In for Pricing
View Details
Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)
RPC31110-03 1 mg

Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)

Sign In for Pricing
View Details
ID3 Antibody
GWB-E28F8D 0.1 mg

ID3 Antibody

Sign In for Pricing
View Details
Bovine Ferritin, Mitochondrial (FTMT) ELISA Kit-Sandwich
EK12F98-01 48 Test

Bovine Ferritin, Mitochondrial (FTMT) ELISA Kit-Sandwich

Sign In for Pricing
View Details