Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)

Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Glutathione S-transferase Mu 3 (Gstm3) . Accession Number: P19639; Gstm3. Expression Region: 2-218aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 33.0kda. Target Synonyms: GST class-mu 3; Glutathione S-transferase GT9.3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3) is a purified Recombinant Protein.

Accession Number

P19639; Gstm3

Expression Region

2-218aa

Host

E. coli

Target

Glutathione S-transferase Mu 3 (Gstm3)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GST class-mu 3; Glutathione S-transferase GT9.3

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

PMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAPNFDRSQWLSEKFNLGLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIQLMIVCCSPDFEKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWGTD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO1 TFact DNA-Binding ELISA Kit
MBS9502170-01 1 Kit

FOXO1 TFact DNA-Binding ELISA Kit

Sign In for Pricing
View Details
FOXO1 TFact DNA-Binding ELISA Kit
MBS9502170-02 5x 1 Kit

FOXO1 TFact DNA-Binding ELISA Kit

Sign In for Pricing
View Details
Anti-ATM Antibody (6V835)
MF-0067132-01 50 µL

Anti-ATM Antibody (6V835)

Sign In for Pricing
View Details
Anti-ATM Antibody (6V835)
MF-0067132-02 100 µL

Anti-ATM Antibody (6V835)

Sign In for Pricing
View Details
CSF3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV668413 1.0 µg DNA

CSF3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FAR1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0757705 3x 1.0 µg

FAR1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details