Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantBDNF, Human

BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology.

Product Specifications

Product Name Alternative

Brain-derived neurotrophic factor, abrineurin

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50<4μg/ml, measured in a bioassay using C6 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

12-14kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human BDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human BDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Glycerol-3-phosphate acyltransferase 1, mitochondrial (GPAM) ELISA Kit
abx525896 96 Tests

Mouse Glycerol-3-phosphate acyltransferase 1, mitochondrial (GPAM) ELISA Kit

Sign In for Pricing
View Details
ALKBH4 antibody
FNab00313 100 µg

ALKBH4 antibody

Sign In for Pricing
View Details
OR5H8P siRNA Oligos set (Human)
35448171 3x 5 nmol

OR5H8P siRNA Oligos set (Human)

Sign In for Pricing
View Details
AccuPower® Gold Multiplex PCR PreMix
K-2117 96 Reactions

AccuPower® Gold Multiplex PCR PreMix

Sign In for Pricing
View Details
ADAM10 Protein Vector (Human) (pPM-C-His)
PV048568 500 ng

ADAM10 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
MitMAB
B7620-10 10 mg

MitMAB

Sign In for Pricing
View Details