Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL17 Protein

This CCL17 Protein spans the amino acid sequence from region 24-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CC chemokine TARC) (Small-inducible cytokine A17) (Thymus and activation-regulated chemokine)

UniProt

Q95N01

Expression Region

24-99aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KUL-7211
HY-19673 1 Each

KUL-7211

Sign In for Pricing
View Details
3,5-Bis (4-aminophenoxy) benzoic Acid
sc-486021 1 g

3,5-Bis (4-aminophenoxy) benzoic Acid

Sign In for Pricing
View Details
Human UHRF1 Knockout HEK293T cell line
GTR15415209 1 Vial

Human UHRF1 Knockout HEK293T cell line

Sign In for Pricing
View Details
PhiKan 083 5mg
A15350-5 5 mg

PhiKan 083 5mg

Sign In for Pricing
View Details
Aclimostat
T39490 5 mg

Aclimostat

Sign In for Pricing
View Details
Methyl 2-hydroxy-3- (2-methoxyphenyl) -2-methylpropanoate
YZB49218-01 50 mg

Methyl 2-hydroxy-3- (2-methoxyphenyl) -2-methylpropanoate

Sign In for Pricing
View Details