Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SELE (HEK) Protein

Recombinant of human SELE (HEK) protein

Product Specifications

Product Name Alternative

E-selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen, SELE, ELAM1, ELAM, ESEL, CD62E.

Source

HEK293 cells

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

SELE was lyophilized from a 0.2 μM filtered solution of PBS and 4% Mannitol, pH 7.5.

AA Sequence

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTF18 (F-1) Alexa Fluor® 790
sc-374632 AF790 200 µg/mL

CTF18 (F-1) Alexa Fluor® 790

Sign In for Pricing
View Details
IL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
24893066 1.0 µg DNA

IL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
H3K27me3 Polyclonal Antibody
bs-53122R 50 µg

H3K27me3 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Nkx2-1 shRNA (UAS) - Lentiviral mouse Nkx2-1 shRNA (UAS, iRFP) (25)
GTR15257390 1 Vial

Lentiviral mouse Nkx2-1 shRNA (UAS) - Lentiviral mouse Nkx2-1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
EVX1 Rabbit Polyclonal Antibody (HRP)
orb2100731 100 µL

EVX1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CD42d Polyclonal Antibody
41952-01 50 µL

CD42d Polyclonal Antibody

Sign In for Pricing
View Details