Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine Thrombin Protein

Porcine Thrombin protein

Product Specifications

Source

Porcine Blood

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized porcine Thrombin in sterile 0.9% NaCl.

Storage Conditions

Stability: Lyophilized Porcine Thrombin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IPF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

Lyophilized Powder from glycine, calcium chloride pH 7.0 containing 0.9% NaCl

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
orb1981259-01 5 mg

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
orb1981259-02 50 mg

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
RPSAP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2063107 1.0 µg DNA

RPSAP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3) (APC)
MBS6166023-01 0.1 mL

HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3) (APC)

Sign In for Pricing
View Details
HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3) (APC)
MBS6166023-02 5x 0.1 mL

HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3) (APC)

Sign In for Pricing
View Details
Human FRS2 Alexa Fluor 488 Antibody (Clone 462902)
IC40691G-100UG 100 µg

Human FRS2 Alexa Fluor 488 Antibody (Clone 462902)

Sign In for Pricing
View Details