STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
This synthetic peptide, with the sequence STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, is derived from the angiotensin-converting enzyme 2 (ACE2) protein. It serves as a research tool for investigating ACE2's biochemical interactions and functions in both in vitro binding assays and cellular studies related to cardiovascular and pulmonary research.
Product Specifications
Field of Research
Metabolism Research
Molecular Weight
3649.88
Storage Conditions
-20°C
Notes
For research use only.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog