HIV-1 Integrase Protein
Recombinant of HIV-1 Integrase protein
Product Specifications
Source
Escherichia Coli
Field of Research
Infectious Disease & Virology
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile filtered colorless clear solution.
Storage Conditions
Stability: HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Applications: HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems
Preservative
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol.
AA Sequence
MFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEDHHHHHH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2061653-01 0.1 mL
PE-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
Sign In for Pricing
View Details MBS2061653-02 0.2 mL
PE-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
Sign In for Pricing
View Details MBS2061653-03 0.5 mL
PE-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
Sign In for Pricing
View Details MBS2061653-04 1 mL
PE-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
Sign In for Pricing
View Details