ARF1 Peptide - N-terminal region
ARF1 Peptide - N-terminal region
Product Specifications
UniProt
P84077
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARF1 Rabbit Polyclonal Antibody (orb588561) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001019397.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0525-500 1x 500 µL
CD63 (MX-49.129.5), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GM-40-10 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human Lambda, 10nm
Sign In for Pricing
View Details ![Cleaved PARP1 Recombinant Rabbit Monoclonal Antibody [JE00-15]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea819f7/imageurl/ha722218.webp)
HA722218 100 µL
Cleaved PARP1 Recombinant Rabbit Monoclonal Antibody [JE00-15]
Sign In for Pricing
View Details 
![PCK2 Recombinant Rabbit Monoclonal Antibody [JB52-39]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81c62/imageurl/et7107-29.webp)
ET7107-29 100 µL
PCK2 Recombinant Rabbit Monoclonal Antibody [JB52-39]
Sign In for Pricing
View Details 