IL-13, Mouse (CHO, His)
IL-13 Protein, Mouse (CHO, His), an important CHO cell derived cytokine, is a multifunctional cytokine whose principal action is to diminish inflammatory responses.
Product Specifications
Product Name Alternative
IL-13 Protein, Mouse (CHO, His), Mouse, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-13-protein-mouse-cho-his.html
Purity
95.00
Smiles
PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH
Molecular Formula
16163 (Gene_ID) P20109 (P22-F131) (Accession)
Molecular Weight
Approximately 14-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Ma Y, et al. Novel recombinant interleukin-13 peptide-based vaccine reduces airway allergic inflammatoryresponses in mice. Am J Respir Crit Care Med. 2007 Sep 1;176 (5) :439-45.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Human cIAP2 Recombinant Rabbit Monoclonal Antibody [PSH09-39] - BSA and Azide free (Capture/Detector)](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81609/imageurl/ha723099.webp)
HA723099 100 µL
Human cIAP2 Recombinant Rabbit Monoclonal Antibody [PSH09-39] - BSA and Azide free (Capture/Detector)
Sign In for Pricing
View Details 
LC419940 20 µg
IRE1 (ERN1) (NM_001433) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC470457-500 1x 500 µL
Cytokeratin, multi (KRT/457), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH034104-01 20 µg
Recombinant Human IL-16 (129 a.a.) protein (N-His)
Sign In for Pricing
View Details PKSH034104-02 100 µg
Recombinant Human IL-16 (129 a.a.) protein (N-His)
Sign In for Pricing
View Details