Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adrenodoxin, mitochondrial (FDX1)

Product Specifications

Product Name Alternative

(Adrenal ferredoxin) (Ferredoxin-1) (Hepatoredoxin)

Abbreviation

Recombinant Human FDX1 protein

Gene Name

FDX1

UniProt

P10109

Expression Region

61-184aa

Organism

Homo sapiens (Human)

Target Sequence

SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.0 kDa

References & Citations

"Homozygous disruption of P450 side-chain cleavage (CYP11A1) is associated with prematurity, complete 46, XY sex reversal, and severe adrenal failure." Hiort O., Holterhus P.M., Werner R., Marschke C., Hoppe U., Partsch C.J., Riepe F.G., Achermann J.C., Struve D. J Clin Endocrinol Metab 90:538-541 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRGAP1 antibody
FNab08224 100 µg

SRGAP1 antibody

Sign In for Pricing
View Details
KRT18P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1170307 1.0 µg DNA

KRT18P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)
MBS2084135-01 0.1 mL

FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)
MBS2084135-02 0.2 mL

FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)
MBS2084135-03 0.5 mL

FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)
MBS2084135-04 1 mL

FITC-Linked Polyclonal Antibody to Progesterone Immunomodulatory Binding Factor 1 (PIBF1)

Sign In for Pricing
View Details