Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine SCF protein

The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 403507) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

27.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-1b/IL-1F2 (Interleukin 1b) Monkey ELISA Kit
E2067 96 Tests

IL-1b/IL-1F2 (Interleukin 1b) Monkey ELISA Kit

Sign In for Pricing
View Details
GLP-1 (9-36) amide (TFA)
HY-P1141A-01 5 mg

GLP-1 (9-36) amide (TFA)

Sign In for Pricing
View Details
GLP-1 (9-36) amide (TFA)
HY-P1141A-02 10 mg

GLP-1 (9-36) amide (TFA)

Sign In for Pricing
View Details
Methyl 4-Hydroxy-2-methyl-2H-Thieno[2,3-e]-1,2-thiazine-3-carboxylic Acid 1,1-Dioxide Ester
455532-01 50 mg

Methyl 4-Hydroxy-2-methyl-2H-Thieno[2,3-e]-1,2-thiazine-3-carboxylic Acid 1,1-Dioxide Ester

Sign In for Pricing
View Details
Methyl 4-Hydroxy-2-methyl-2H-Thieno[2,3-e]-1,2-thiazine-3-carboxylic Acid 1,1-Dioxide Ester
455532-02 100 mg

Methyl 4-Hydroxy-2-methyl-2H-Thieno[2,3-e]-1,2-thiazine-3-carboxylic Acid 1,1-Dioxide Ester

Sign In for Pricing
View Details
RTP4 Protein Vector (Rat) (pPM-C-His)
PV303017 500 ng

RTP4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details