Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

This Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) spans the amino acid sequence from region 1-45aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ns4.8, 4.8 kDa accessory protein

UniProt

Q8V6W4

Expression Region

1-45aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bovine coronavirus (strain Quebec) (BCoV) (BCV)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPMATTIDGTDYTNIMPSTVSTRVYLGCSIGIDTSTTGFTCFSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIN3A Conjugated Antibody
orb1624919 100 µL

SIN3A Conjugated Antibody

Sign In for Pricing
View Details
Ap4s1 Peptide - N-terminal region
orb2005958 100 µg

Ap4s1 Peptide - N-terminal region

Sign In for Pricing
View Details
Ccdc85c (NM_001159910) Mouse Untagged Clone
MC215425 10 µg

Ccdc85c (NM_001159910) Mouse Untagged Clone

Sign In for Pricing
View Details
IL13RA2 (Interleukin-13 Receptor Subunit alpha-2, IL-13 Receptor Subunit alpha-2, IL-13R Subunit alpha-2, IL-13R-alpha-2, IL-13RA2, Interleukin 13 Receptor, alpha 2, IL-13R, IL13R, CD213a2, CT19, Interleukin-13-binding Protein, IL13BP) (FITC)
128395-FITC 100 µL

IL13RA2 (Interleukin-13 Receptor Subunit alpha-2, IL-13 Receptor Subunit alpha-2, IL-13R Subunit alpha-2, IL-13R-alpha-2, IL-13RA2, Interleukin 13 Receptor, alpha 2, IL-13R, IL13R, CD213a2, CT19, Interleukin-13-binding Protein, IL13BP) (FITC)

Sign In for Pricing
View Details
Surfactant protein D (SFTPD) (NM_003019) Human Tagged Lenti ORF Clone
RC204746L3 10 µg

Surfactant protein D (SFTPD) (NM_003019) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APP Detection Antibody
OAOA22126-50UG 50 µg

APP Detection Antibody

Sign In for Pricing
View Details