Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap4s1 Peptide - N-terminal region

Ap4s1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI314282

UniProt

Q9WVL1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ap4s1 Rabbit Polyclonal Antibody (orb581649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068356

Preservative

Lyophilized powder

AA Sequence

KFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-API5-Neo Plasmid
PVT72476 2 µg

PCMV-EGFP-API5-Neo Plasmid

Sign In for Pricing
View Details
ZNF8 (NM_021089) Human Tagged ORF Clone
RC207338 10 µg

ZNF8 (NM_021089) Human Tagged ORF Clone

Sign In for Pricing
View Details
3- ({2-[ (4-bromophenyl) amino]-2-oxoethyl}thio) propanoic acid
sc-343981 250 mg

3- ({2-[ (4-bromophenyl) amino]-2-oxoethyl}thio) propanoic acid

Sign In for Pricing
View Details
Phospho-ARHGAP35 (Y1105) Antibody
CSB-PA009001-01 50 µg

Phospho-ARHGAP35 (Y1105) Antibody

Sign In for Pricing
View Details
Phospho-ARHGAP35 (Y1105) Antibody
CSB-PA009001-02 100 µg

Phospho-ARHGAP35 (Y1105) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RUSC2 Antibody [PerCP]
NBP2-81785PCP 0.1 mL

Rabbit Polyclonal RUSC2 Antibody [PerCP]

Sign In for Pricing
View Details