Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Spike glycoprotein (S), partial

This Recombinant Bovine coronavirus Spike glycoprotein (S), partial spans the amino acid sequence from region 314-634aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S glycoprotein, E2, Peplomer protein

UniProt

Q8V436

Expression Region

314-634aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKTSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDHCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 Antibody (Center) [APR16145G]
APR16145G-01 50 µL

GIT1 Antibody (Center) [APR16145G]

Sign In for Pricing
View Details
GIT1 Antibody (Center) [APR16145G]
APR16145G-02 100 µL

GIT1 Antibody (Center) [APR16145G]

Sign In for Pricing
View Details
GIT1 Antibody (Center) [APR16145G]
APR16145G-03 200 µL

GIT1 Antibody (Center) [APR16145G]

Sign In for Pricing
View Details
GIT1 Antibody (Center) [APR16145G]
APR16145G-04 400 µL

GIT1 Antibody (Center) [APR16145G]

Sign In for Pricing
View Details
PERK (EIF2AK3) Rabbit Polyclonal Antibody
TA314918 100 µL

PERK (EIF2AK3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MART-1 Conjugated Antibody
C33429 100 µL

MART-1 Conjugated Antibody

Sign In for Pricing
View Details