Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea Pig Interferon gamma (Ifng), partial

This Recombinant Guinea Pig Interferon gamma (Ifng), partial spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8CGS0

Expression Region

24-166aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Cavia porcellus (Guinea pig)

Field of Research

Infectious Disease & Virology; Neuroscience; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSRFTNEIRILKNYFNADNSDVGDNGTLFVGILKNCQEESERKIFQSQIVSFYFKLFEKHFTDNQTVQNSMNTIKEQIITKFFKDNSSNKVQAFKNLIQISVNDEHVQRQAIIELKKVIDDLSPNQRKRRRTQMLFQSRRASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNA1G + CACNA1H Rabbit Polyclonal Antibody (APC-Cy7)
orb2538969 100 µL

CACNA1G + CACNA1H Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
PSAT1 antibody
FNab06846 100 µg

PSAT1 antibody

Sign In for Pricing
View Details
Anti-PYCR2 antibody
STJ25246 100 µl

Anti-PYCR2 antibody

Sign In for Pricing
View Details
Ccnl1 Peptide - N-terminal region
orb2007947 100 µg

Ccnl1 Peptide - N-terminal region

Sign In for Pricing
View Details
TMEM25 (NM_001144036) Human Tagged Lenti ORF Clone
RC227459L4 10 µg

TMEM25 (NM_001144036) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal CD59 Antibody (SPM616) [Alexa Fluor 488]
NBP2-47821AF488 0.1 mL

Mouse Monoclonal CD59 Antibody (SPM616) [Alexa Fluor 488]

Sign In for Pricing
View Details