Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccnl1 Peptide - N-terminal region

Ccnl1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ania-6a, Ccnl|MGC93069, Ccnl

UniProt

Q9R1Q2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccnl1 Rabbit Polyclonal Antibody (orb574545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446114

Preservative

Lyophilized powder

AA Sequence

MATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-Cyanophenyl) -4-piperidinecarbohydrazide
OR25906-01 250 mg

1- (4-Cyanophenyl) -4-piperidinecarbohydrazide

Sign In for Pricing
View Details
1- (4-Cyanophenyl) -4-piperidinecarbohydrazide
OR25906-02 1 g

1- (4-Cyanophenyl) -4-piperidinecarbohydrazide

Sign In for Pricing
View Details
Mouse Monoclonal Nrf1 Antibody (NRF1/2609) [Allophycocyanin]
NBP3-08773APC 0.1 mL

Mouse Monoclonal Nrf1 Antibody (NRF1/2609) [Allophycocyanin]

Sign In for Pricing
View Details
Dihydroneopterin
TRC-D453600-10MG 10 mg

Dihydroneopterin

Sign In for Pricing
View Details
C2orf16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0222307 1.0 µg DNA

C2orf16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Sorting Nexin-16 (SNX16) Antibody
abx432188 200 µL

Sorting Nexin-16 (SNX16) Antibody

Sign In for Pricing
View Details