Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme C (Gzmc)

This Recombinant Mouse Granzyme C (Gzmc) spans the amino acid sequence from region 21-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B10 (Cytotoxic cell protease 2) (CCP2)

UniProt

P08882

Expression Region

21-248aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGSSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ACADL Pre-designed siRNA Set A
SI000127A 1 Each

Human ACADL Pre-designed siRNA Set A

Sign In for Pricing
View Details
LIPM (NM_001128215) Human Recombinant Protein
TP325684L 1 mg

LIPM (NM_001128215) Human Recombinant Protein

Sign In for Pricing
View Details
Rat Factor Xa
orb2942725-01 50 mg

Rat Factor Xa

Sign In for Pricing
View Details
Rat Factor Xa
orb2942725-02 10 mg

Rat Factor Xa

Sign In for Pricing
View Details
Eppendorf epTIPS Box 2.0 50-1000uL 1 reusable box x 96 tips
E0030076176 96 / PCK

Eppendorf epTIPS Box 2.0 50-1000uL 1 reusable box x 96 tips

Sign In for Pricing
View Details
PECAM1 Antibody
OAEE00202-100UG 0.1 mg (C100)

PECAM1 Antibody

Sign In for Pricing
View Details