Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial

This Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial spans the amino acid sequence from region 248-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heparin-binding protein 44 (HBP-44) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP)

UniProt

P55302

Expression Region

248-360aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ImmoRoom Temperaturealized Monkey Primary Liver Epithelial Cells
NHFF-1123-HX471 Each

ImmoRoom Temperaturealized Monkey Primary Liver Epithelial Cells

Sign In for Pricing
View Details
Anaphase-Promoting Complex Subunit 13 (ANAPC13) Antibody
abx135887-01 60 µL

Anaphase-Promoting Complex Subunit 13 (ANAPC13) Antibody

Sign In for Pricing
View Details
Anaphase-Promoting Complex Subunit 13 (ANAPC13) Antibody
abx135887-02 120 µL

Anaphase-Promoting Complex Subunit 13 (ANAPC13) Antibody

Sign In for Pricing
View Details
Anaphase-Promoting Complex Subunit 13 (ANAPC13) Antibody
abx135887-03 200 µL

Anaphase-Promoting Complex Subunit 13 (ANAPC13) Antibody

Sign In for Pricing
View Details
Spongionellol A
HY-N10491 1 Each

Spongionellol A

Sign In for Pricing
View Details
Synpo2l-set siRNA/shRNA/RNAi Lentivector (Mouse)
45982094 4x 500 ng

Synpo2l-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details