Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

This Recombinant Human Protein lin-28 homolog A (LIN28A), partial spans the amino acid sequence from region 39-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger CCHC domain-containing protein 1

UniProt

Q9H9Z2

Expression Region

39-112aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TWA1 Antibody
5305-01 0.02 mg

TWA1 Antibody

Sign In for Pricing
View Details
TWA1 Antibody
5305-02 0.1 mg

TWA1 Antibody

Sign In for Pricing
View Details
1-[2- (4-Fluorophenyl) ethynyl]cyclopentanol
PC1021756 1 Each

1-[2- (4-Fluorophenyl) ethynyl]cyclopentanol

Sign In for Pricing
View Details
Anti-Quiescin Q6/QSOX1 Antibody Picoband® (Dylight488 Conjugate)
A04549-1-Dylight488 100 µg

Anti-Quiescin Q6/QSOX1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
MMP14 Antibody
orb333978 100 µL

MMP14 Antibody

Sign In for Pricing
View Details
5-Nonadecylresorcinol
HY-113242-01 5 mg

5-Nonadecylresorcinol

Sign In for Pricing
View Details