Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial

This Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial spans the amino acid sequence from region 502-637aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Envelope glycoprotein (GP1,2) (GP) [Cleaved into, GP1, GP2, Shed GP (GP1,2-delta) ]

UniProt

Q7T9D9

Expression Region

502-637aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Sudan ebolavirus (strain Uganda-00) (SEBOV) (Sudan Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVK (NM_001114185) Human Over-expression Lysate
LY426476 100 µg

MVK (NM_001114185) Human Over-expression Lysate

Sign In for Pricing
View Details
TMED10 Polyclonal Antibody
E-AB-19178-01 20 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
TMED10 Polyclonal Antibody
E-AB-19178-02 60 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
TMED10 Polyclonal Antibody
E-AB-19178-03 120 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
TMED10 Polyclonal Antibody
E-AB-19178-04 200 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB505699 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details