Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plexin-B1 (PLXNB1), partial (Active)

This Recombinant Human Plexin-B1 (PLXNB1), partial (Active) spans the amino acid sequence from region 20-535aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Semaphorin receptor SEP)

UniProt

O43157

Expression Region

20-535aa

Tag

N-terminal mFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5 μg/mL can bind human PLXNB1, the EC50 is 0.8179-1.357 μg/mL.

Form

Lyophilized powder

Molecular Weight

83.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPARGC (PPARGC1A, LEM6, PGC1, PGC1A, PPARGC1, Peroxisome proliferator-activated receptor gamma coactivator 1-alpha, Ligand effect modulator 6) (HRP) discontinued
031202-HRP 100 µL

PPARGC (PPARGC1A, LEM6, PGC1, PGC1A, PPARGC1, Peroxisome proliferator-activated receptor gamma coactivator 1-alpha, Ligand effect modulator 6) (HRP) discontinued

Sign In for Pricing
View Details
Venadaparib (IDX-1197)
S9893-25mg 25 mg

Venadaparib (IDX-1197)

Sign In for Pricing
View Details
GTSE1 Antibody
MBS9609270-01 0.1 mL

GTSE1 Antibody

Sign In for Pricing
View Details
GTSE1 Antibody
MBS9609270-02 0.2 mL

GTSE1 Antibody

Sign In for Pricing
View Details
GTSE1 Antibody
MBS9609270-03 5x 0.2 mL

GTSE1 Antibody

Sign In for Pricing
View Details
Endothelial Cell Adhesion Molecule (ESAM) Human ELISA Kit
D1700 96 Tests

Endothelial Cell Adhesion Molecule (ESAM) Human ELISA Kit

Sign In for Pricing
View Details