Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5C, Human (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in regulating allergic and inflammatory processes. RAB5C Protein, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RAB5C Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rab5c-human-hek293-his.html

Purity

98.0

Smiles

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Molecular Formula

5878 (Gene_ID) NP_958842 (M1-N216) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mybpc1 (NM_175418) Mouse Tagged Lenti ORF Clone
MR211664L4 10 µg

Mybpc1 (NM_175418) Mouse Tagged Lenti ORF Clone

Ask
View Details
Hepatitis B Surface Ag (HBsAg), Antibody
GWB-DCFC95 1 mg

Hepatitis B Surface Ag (HBsAg), Antibody

Ask
View Details
BRCA1 (NM_007294) Human Tagged Lenti ORF Clone
RC219679L1 10 µg

BRCA1 (NM_007294) Human Tagged Lenti ORF Clone

Ask
View Details
Human IL-4 R alpha Biotinylated Affinity Purified PAb
BAF230 50 µg

Human IL-4 R alpha Biotinylated Affinity Purified PAb

Ask
View Details
GRAF, CT (GTPase Regulator Associated with Focal Adhesion Kinase, ARHGAP26, FLJ42530, KIAA0621, Oligophrenin-1-like Protein, OPHN1L, OPHN1L1, Rho GTPase Activating Protein 26, Rho-type GTPase-activating Protein 26)
MBS643932-01 0.2 mL

GRAF, CT (GTPase Regulator Associated with Focal Adhesion Kinase, ARHGAP26, FLJ42530, KIAA0621, Oligophrenin-1-like Protein, OPHN1L, OPHN1L1, Rho GTPase Activating Protein 26, Rho-type GTPase-activating Protein 26)

Ask
View Details
GRAF, CT (GTPase Regulator Associated with Focal Adhesion Kinase, ARHGAP26, FLJ42530, KIAA0621, Oligophrenin-1-like Protein, OPHN1L, OPHN1L1, Rho GTPase Activating Protein 26, Rho-type GTPase-activating Protein 26)
MBS643932-02 5x 0.2 mL

GRAF, CT (GTPase Regulator Associated with Focal Adhesion Kinase, ARHGAP26, FLJ42530, KIAA0621, Oligophrenin-1-like Protein, OPHN1L, OPHN1L1, Rho GTPase Activating Protein 26, Rho-type GTPase-activating Protein 26)

Ask
View Details