What is the catalog number for CD210 Recombinant Protein?

The catalog number for CD210 Recombinant Protein is orb1088580.

What sizes are available for CD210 Recombinant Protein?

CD210 Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does CD210 Recombinant Protein come in?

CD210 Recombinant Protein is available in 2 different pack sizes.

Is CD210 Recombinant Protein in stock?

CD210 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

CD210 Recombinant Protein

Product Specifications

UniProt

Q13651

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~26kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSY DLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG KIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEF CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B2014033 10 µg

Human CK1 Œµ Protein Active

Sign In for Pricing

View Details

orb1329011 100 µg

GTF2B Antibody

Sign In for Pricing

View Details

K2461307 1.0 µg DNA

TRGV5P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing

View Details

bs-8264R-BF350 100 µL

DHRS4 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing

View Details

339397-01 50 µg

VASP (Vasodilator Stimulated Phosphoprotein)

Sign In for Pricing

View Details

339397-02 100 µg

VASP (Vasodilator Stimulated Phosphoprotein)

Sign In for Pricing

View Details