Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ULBP1 protein

This Human ULBP1 protein spans the amino acid sequence from region 26-216aa. Purity: Greater than 93% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)

UniProt

Q9BZM6

Expression Region

26-216aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 93% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml. 2Human KLRK1 protein Fc tag captured on COOH chip can bind Human ULBP1 protein Fc/myc tag with an affinity constant of 2.27 nM as detected by LSPR Assay.

Form

Lyophilized powder

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RPLP2 sgRNA gene knockout kit - Lentiviral human RPLP2 sgRNA gene knockout kit (plasmid)
GTR15364253 1 Vial

Lentiviral human RPLP2 sgRNA gene knockout kit - Lentiviral human RPLP2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GNPAT Rabbit Polyclonal Antibody (FITC)
orb8189 100 µL

GNPAT Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ASGR2 Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124385-01 0.1 mL

ASGR2 Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
ASGR2 Antibody, Rabbit PAb, Antigen Affinity Purified
MBS8124385-02 5x 0.1 mL

ASGR2 Antibody, Rabbit PAb, Antigen Affinity Purified

Sign In for Pricing
View Details
Loncastuximab
HY-P99711-01 1 mg

Loncastuximab

Sign In for Pricing
View Details
Loncastuximab
HY-P99711-02 5 mg

Loncastuximab

Sign In for Pricing
View Details