Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine GRA6 protein

This Canine GRA6 protein spans the amino acid sequence from region 35-150aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen p32 (Protein p33)

UniProt

Q27003

Expression Region

35-150aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Toxoplasma gondii

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT1 Antibody / SLC22A1
R31293 100 µg

OCT1 Antibody / SLC22A1

Sign In for Pricing
View Details
MK shRNA (h) Lentiviral Particles
sc-39711-V 200 µL

MK shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
LIMD1 (NM_014240) Human Over-expression Lysate
LS008994 100 µg

LIMD1 (NM_014240) Human Over-expression Lysate

Sign In for Pricing
View Details
MAGEB6 (NM_173523) Human Mass Spec Standard
PH309603 10 µg

MAGEB6 (NM_173523) Human Mass Spec Standard

Sign In for Pricing
View Details
Agrin monoclonal antibody (Agr-131)
ADI-AGR-530-D 50 µg

Agrin monoclonal antibody (Agr-131)

Sign In for Pricing
View Details
Recombinant Human MYH9 Protein, N-His
orb3061838-01 50 µg

Recombinant Human MYH9 Protein, N-His

Sign In for Pricing
View Details