Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPTA1 protein

This Human SPTA1 protein spans the amino acid sequence from region 53-474aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Erythroid alpha-spectrin

UniProt

P02549

Expression Region

53-474aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF594 conjugate, 0.1mg/mL
BNC940807-500 1x 500 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-SYP121 | Syntaxin 121
AS22 4827 50 µg

Anti-SYP121 | Syntaxin 121

Sign In for Pricing
View Details
Recombinant Caspase 11 Monoclonal Antibody
E-AB-81461-01 50 µL

Recombinant Caspase 11 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Caspase 11 Monoclonal Antibody
E-AB-81461-02 100 µL

Recombinant Caspase 11 Monoclonal Antibody

Sign In for Pricing
View Details
MVK Polyclonal Antibody
E-AB-11414-01 20 µL

MVK Polyclonal Antibody

Sign In for Pricing
View Details
MVK Polyclonal Antibody
E-AB-11414-02 60 µL

MVK Polyclonal Antibody

Sign In for Pricing
View Details