Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TEAD4 protein

This Human TEAD4 protein spans the amino acid sequence from region 74-434aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TEA domain family member 4 Short name, TEAD-4 Transcription factor 13-like 1 Transcription factor RTEF-1

UniProt

Q15561

Expression Region

74-434aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human gamma-Synuclein Antibody (Biotin Conjugate)
12081-05021 150 µg

Human gamma-Synuclein Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
Gstcd (NM_001107725) Rat Tagged Lenti ORF Clone
RR212912L3 10 µg

Gstcd (NM_001107725) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Myf-5 (B-10) Alexa Fluor® 594
sc-518056 AF594 200 µg/mL

Myf-5 (B-10) Alexa Fluor® 594

Sign In for Pricing
View Details
RIP1 kinase inhibitor 4
HY-153434 1 Each

RIP1 kinase inhibitor 4

Sign In for Pricing
View Details
4-Phenyl-5- (piperidin-1-yl) -4H-1,2,4-triazole-3-thiol
SDA11077-01 0.5 g

4-Phenyl-5- (piperidin-1-yl) -4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
4-Phenyl-5- (piperidin-1-yl) -4H-1,2,4-triazole-3-thiol
SDA11077-02 5 g

4-Phenyl-5- (piperidin-1-yl) -4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details