Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Epcam protein

This Mouse Epcam protein spans the amino acid sequence from region 24-266aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epithelial glycoprotein 314 Short name: EGP314 Short name: mEGP314 Protein 289A Tumor-associated calcium signal transducer 1 CD_antigen: CD326

UniProt

Q99JW5

Expression Region

24-266aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A*0201 WT-1 Complex, Human (HEK293, His-Avi)
HY-P77792-01 20 µg

HLA-A*0201 WT-1 Complex, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
HLA-A*0201 WT-1 Complex, Human (HEK293, His-Avi)
HY-P77792-02 50 µg

HLA-A*0201 WT-1 Complex, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
HLA-A*0201 WT-1 Complex, Human (HEK293, His-Avi)
HY-P77792-03 100 µg

HLA-A*0201 WT-1 Complex, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
4-Piperidyl N- (2-biphenyl) carbamate
HY-W076756-01 1 g

4-Piperidyl N- (2-biphenyl) carbamate

Sign In for Pricing
View Details
4-Piperidyl N- (2-biphenyl) carbamate
HY-W076756-02 5 g

4-Piperidyl N- (2-biphenyl) carbamate

Sign In for Pricing
View Details
4-Piperidyl N- (2-biphenyl) carbamate
HY-W076756-03 10 g

4-Piperidyl N- (2-biphenyl) carbamate

Sign In for Pricing
View Details