Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CspA protein

This cspA protein spans the amino acid sequence from region 2-70aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

7.4 kDa cold shock protein CS7.4

UniProt

P0A9Y5

Expression Region

2-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Salmonella enteritidis

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD7, N-His
MBS1573207-01 0.1 mg

Recombinant Human CD7, N-His

Sign In for Pricing
View Details
Recombinant Human CD7, N-His
MBS1573207-02 1 mg

Recombinant Human CD7, N-His

Sign In for Pricing
View Details
Recombinant Human CD7, N-His
MBS1573207-03 5x 1 mg

Recombinant Human CD7, N-His

Sign In for Pricing
View Details
ZNF133 Rabbit Polyclonal Antibody (FITC)
orb2133151 100 µL

ZNF133 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MAPK1/3 Rabbit Polyclonal Antibody (FITC)
orb2580035 100 µg

MAPK1/3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
H2-Ob Recombinant Protein (Mouse)
RP140744 100 µg

H2-Ob Recombinant Protein (Mouse)

Sign In for Pricing
View Details