Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF133 Rabbit Polyclonal Antibody (FITC)

ZNF133 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF150, pHZ-13, pHZ-66

UniProt

Q53XU1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

IF, WB

NCBI Accession Number

NP_003425

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R3B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B'', beta, NY-REN-8, PPP2R3L, PPP2R3LY, PR48) (HRP)
MBS6451447-01 0.1 mL

PPP2R3B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B'', beta, NY-REN-8, PPP2R3L, PPP2R3LY, PR48) (HRP)

Sign In for Pricing
View Details
PPP2R3B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B'', beta, NY-REN-8, PPP2R3L, PPP2R3LY, PR48) (HRP)
MBS6451447-02 5x 0.1 mL

PPP2R3B (Protein Phosphatase 2 (formerly 2A), Regulatory Subunit B'', beta, NY-REN-8, PPP2R3L, PPP2R3LY, PR48) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Ece1 shRNA (UAS) - Lentiviral mouseEce1 shRNA (UAS, GFP) (25)
GTR15174416 1 Vial

Lentiviral mouse Ece1 shRNA (UAS) - Lentiviral mouseEce1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human IL-17A/IL-4 Dual Fluorospot Set
MBS335628-01 96 Well (Sterile Plate)

Human IL-17A/IL-4 Dual Fluorospot Set

Sign In for Pricing
View Details
Human IL-17A/IL-4 Dual Fluorospot Set
MBS335628-02 10x 96 Well (Sterile Plate)

Human IL-17A/IL-4 Dual Fluorospot Set

Sign In for Pricing
View Details
Human IL-17A/IL-4 Dual Fluorospot Set
MBS335628-03 15x 96 Well (Sterile Plate)

Human IL-17A/IL-4 Dual Fluorospot Set

Sign In for Pricing
View Details