Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Slc30a8 protein

This Mouse Slc30a8 protein spans the amino acid sequence from region 1-367aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 30 member 8

UniProt

Q8BGG0

Expression Region

1-367aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Peg10 shRNA (UAS) - Lentiviral mouse Peg10 shRNA (UAS) (100)
GTR15268014 1 Vial

Lentiviral mouse Peg10 shRNA (UAS) - Lentiviral mouse Peg10 shRNA (UAS) (100)

Sign In for Pricing
View Details
Test tube
2067320/1A 1 Each

Test tube

Sign In for Pricing
View Details
ARF6 discontinued
306662 100 µL

ARF6 discontinued

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated
orb3008362-01 20 µg

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated
orb3008362-02 100 µg

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated
orb3008362-03 1 mg

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

Sign In for Pricing
View Details