Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin (A5), CF488A conjugate, 0.1mg/mL
BNC880308-100 1x 100 µL

Laminin (A5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SLAMF8 Protein (His Tag)
PKSH033064-01 10 µg

Recombinant Human SLAMF8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SLAMF8 Protein (His Tag)
PKSH033064-02 50 µg

Recombinant Human SLAMF8 Protein (His Tag)

Sign In for Pricing
View Details
CD51 / Integrin V (ITGAV/1610), CF568 conjugate, 0.1mg/mL
BNC681610-100 1x 100 µL

CD51 / Integrin V (ITGAV/1610), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAB34 Rabbit Polyclonal Antibody
TA380629 100 µL

RAB34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Car8 Mouse Gene Knockout Kit (CRISPR)
KN502539 1 Kit

Car8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details