Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hfe protein

This Mouse Hfe protein spans the amino acid sequence from region 25-359aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P70387

Expression Region

25-359aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Guanine nucleotide-binding protein G (s) subunit alpha isoforms XLas (GNAS) , partial
MBS1339729 Inquire

Recombinant Human Guanine nucleotide-binding protein G (s) subunit alpha isoforms XLas (GNAS) , partial

Sign In for Pricing
View Details
GIPC2 siRNA (Human)
CRJ0232-01 15 nmol

GIPC2 siRNA (Human)

Sign In for Pricing
View Details
GIPC2 siRNA (Human)
CRJ0232-02 30 nmol

GIPC2 siRNA (Human)

Sign In for Pricing
View Details
NSD3 (WHSC1L1) (NM_017778) Human Recombinant Protein
PH30214E1 50 µg

NSD3 (WHSC1L1) (NM_017778) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis atpD Protein (aa 1-203) (strain D/UW-3/Cx)
VAng-Lsx6502-1mgEcoli 1 mg (E. coli)

Recombinant Chlamydophila Trachomatis atpD Protein (aa 1-203) (strain D/UW-3/Cx)

Sign In for Pricing
View Details
Recombinant Murine PDGF-BB
P6130-100μg 100 µg

Recombinant Murine PDGF-BB

Sign In for Pricing
View Details