Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLI1 protein

This Human GLI1 protein spans the amino acid sequence from region 921-1106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glioma-associated oncogeneOncogene GLI

UniProt

P08151

Expression Region

921-1106aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CREB1 (Ser133) Polyclonal Antibody
E-AB-20849-01 20 µL

Phospho-CREB1 (Ser133) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CREB1 (Ser133) Polyclonal Antibody
E-AB-20849-02 60 µL

Phospho-CREB1 (Ser133) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CREB1 (Ser133) Polyclonal Antibody
E-AB-20849-03 120 µL

Phospho-CREB1 (Ser133) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CREB1 (Ser133) Polyclonal Antibody
E-AB-20849-04 200 µL

Phospho-CREB1 (Ser133) Polyclonal Antibody

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF568 conjugate, 0.1mg/mL
BNC682561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thomsen-Friedenreich Antigen / CD176 (Pan Carcinoma Marker) (A84-A/F10), 1mg/mL
BNUM1294-50 1x 50 µL

Thomsen-Friedenreich Antigen / CD176 (Pan Carcinoma Marker) (A84-A/F10), 1mg/mL

Sign In for Pricing
View Details