Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL4A1 protein

This Human COL4A1 protein spans the amino acid sequence from region 30-167aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arresten, BSVD, CO4A1_HUMAN, COL4A1, COL4A1 NC1 domain, COL4A2, COL4A3, COL4A4, COL4A5, collagen alpha-1 (IV) chain, Collagen IV Alpha 1 Polypeptide, Collagen IV Alpha 2 Polypeptide, Collagen Of Basement Membrane Alpha 1 Chain, Collagen Of Basement Membrane Alpha 2 Chain, Collagen Type IV Alpha 1, collagen type IV alpha 1 chain, Collagen Type IV Alpha 2, Collagen Type IV Alpha 3, Collagen Type IV Alpha 4, Collagen Type IV Alpha 5, RATOR

UniProt

P02462

Expression Region

30-167aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-183-5p miRNA Agomir
CMN0050-01 5 nmol

Mmu-miR-183-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-183-5p miRNA Agomir
CMN0050-02 10 nmol

Mmu-miR-183-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-183-5p miRNA Agomir
CMN0050-03 20 nmol

Mmu-miR-183-5p miRNA Agomir

Sign In for Pricing
View Details
HOXC13 Protein Vector (Human) (pPM-C-HA)
PV084451 500 ng

HOXC13 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (Azide free) (HRP) discontinued
C2098-79B-HRP 200 µL

CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
6-Thio-GTP tetrasodium
T207731-01 10 mg

6-Thio-GTP tetrasodium

Sign In for Pricing
View Details