Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Amm8 protein

This Animal Amm8 protein spans the amino acid sequence from region 20-84aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-anatoxin Amm VIII (Amm VIII) (AmmVIII) (Neurotoxin 8) (P4)

UniProt

Q7YXD3

Expression Region

20-84aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Androctonus mauritanicus mauritanicus (Scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LKDGYIVNDINCTYFCGRNAYCNELCIKLKGESGYCQWASPYGNSCYCYKLPDHVRTKGPGRCND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB3 Peptide - N-terminal region
orb2010240 100 µg

ITGB3 Peptide - N-terminal region

Sign In for Pricing
View Details
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0292 (MJ0292)
orb2935636-01 20 µg

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0292 (MJ0292)

Sign In for Pricing
View Details
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0292 (MJ0292)
orb2935636-02 100 µg

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0292 (MJ0292)

Sign In for Pricing
View Details
ETS1 (Protein C-ets-1, p54, EWSR2) (FITC)
MBS6377737-01 0.1 mL

ETS1 (Protein C-ets-1, p54, EWSR2) (FITC)

Sign In for Pricing
View Details
ETS1 (Protein C-ets-1, p54, EWSR2) (FITC)
MBS6377737-02 5x 0.1 mL

ETS1 (Protein C-ets-1, p54, EWSR2) (FITC)

Sign In for Pricing
View Details
TAGLN3 Rabbit pAb, PE-Cy5 conjugated
orb2876788 100 µL

TAGLN3 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details