Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGB3 Peptide - N-terminal region

ITGB3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD61, GP3A, GPIIIa, GT, BDPLT2

UniProt

P05106

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGB3 Rabbit Polyclonal Antibody (orb585708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000203

Preservative

Lyophilized powder

AA Sequence

PLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dhtkd1 3'UTR GFP Stable Cell Line
TU155127 1.0 mL

Dhtkd1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MED14 Human siRNA Oligo Duplex (Locus ID 9282)
SR306145 1 Kit

MED14 Human siRNA Oligo Duplex (Locus ID 9282)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP71B5 Polyclonal Antibody
MBS7182800 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CYP71B5 Polyclonal Antibody

Sign In for Pricing
View Details
NAV2 Human shRNA Lentiviral Particle (Locus ID 89797)
TL303022V 500 µL Each

NAV2 Human shRNA Lentiviral Particle (Locus ID 89797)

Sign In for Pricing
View Details
KLK3 (Kallikrein 3, Prostate Specific Antigen, KLK 3, KLK-3, PSA) (MaxLight 550)
MBS6452715-01 0.1 mL

KLK3 (Kallikrein 3, Prostate Specific Antigen, KLK 3, KLK-3, PSA) (MaxLight 550)

Sign In for Pricing
View Details
KLK3 (Kallikrein 3, Prostate Specific Antigen, KLK 3, KLK-3, PSA) (MaxLight 550)
MBS6452715-02 5x 0.1 mL

KLK3 (Kallikrein 3, Prostate Specific Antigen, KLK 3, KLK-3, PSA) (MaxLight 550)

Sign In for Pricing
View Details