Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Tb2-II protein

This Animal Tb2-II protein spans the amino acid sequence from region 1-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P-Mice-Ins-beta* NaTx5.4

UniProt

P60276

Expression Region

1-62aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Tityus bahiensis (Brazilian scorpion)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A7 (NM_001144884) Human Mass Spec Standard
PH327524 10 µg

SLC30A7 (NM_001144884) Human Mass Spec Standard

Sign In for Pricing
View Details
Cellubrevin Recombinant Antibody, PerCP Conjugated
bsm-61902R-PerCP-01 20 µL

Cellubrevin Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Cellubrevin Recombinant Antibody, PerCP Conjugated
bsm-61902R-PerCP-02 100 µL

Cellubrevin Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Sphingomyelin Synthase 2 (aa 1-79) Human Recombinant
B2017564 50 µg

Sphingomyelin Synthase 2 (aa 1-79) Human Recombinant

Sign In for Pricing
View Details
ZP3 siRNA (Human)
CRH5272-01 15 nmol

ZP3 siRNA (Human)

Sign In for Pricing
View Details
ZP3 siRNA (Human)
CRH5272-02 30 nmol

ZP3 siRNA (Human)

Sign In for Pricing
View Details