Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RSPO1 protein

This Human RSPO1 protein spans the amino acid sequence from region 31-263aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1

UniProt

Q2MKA7

Expression Region

31-263aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells is 1-10ng/ml.

Form

Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-related Protein 1, ZRP 1, ZRP1, ZRP-1)
146740 100 µg

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-related Protein 1, ZRP 1, ZRP1, ZRP-1)

Sign In for Pricing
View Details
CCNE2 Peptide - N-terminal region
orb1998357 100 µg

CCNE2 Peptide - N-terminal region

Sign In for Pricing
View Details
T4 Polynucleotide Kinase
K013-A 250 U

T4 Polynucleotide Kinase

Sign In for Pricing
View Details
Rb (phospho-Ser807/811) rabbit pAb
E013570 100 µg -100 µL

Rb (phospho-Ser807/811) rabbit pAb

Sign In for Pricing
View Details
TLR9 Polyclonal Antibody
UB-GEN-7068 100 µL

TLR9 Polyclonal Antibody

Sign In for Pricing
View Details
Human ORMDL1 Pre-designed siRNA Set B
SI011475B 1 Each

Human ORMDL1 Pre-designed siRNA Set B

Sign In for Pricing
View Details