Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNE2 Peptide - N-terminal region

CCNE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CYCE2

UniProt

O96020

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_477097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synapsin-1 (phospho Ser553) rabbit pAb
ES8439-01 50 µL

Synapsin-1 (phospho Ser553) rabbit pAb

Sign In for Pricing
View Details
Synapsin-1 (phospho Ser553) rabbit pAb
ES8439-02 100 µL

Synapsin-1 (phospho Ser553) rabbit pAb

Sign In for Pricing
View Details
Canine Matrix metalloproteinase 14 ELISA Kit
MBS7201754-01 48 Well

Canine Matrix metalloproteinase 14 ELISA Kit

Sign In for Pricing
View Details
Canine Matrix metalloproteinase 14 ELISA Kit
MBS7201754-02 96 Well

Canine Matrix metalloproteinase 14 ELISA Kit

Sign In for Pricing
View Details
Canine Matrix metalloproteinase 14 ELISA Kit
MBS7201754-03 5x 96 Well

Canine Matrix metalloproteinase 14 ELISA Kit

Sign In for Pricing
View Details
Canine Matrix metalloproteinase 14 ELISA Kit
MBS7201754-04 10x 96 Well

Canine Matrix metalloproteinase 14 ELISA Kit

Sign In for Pricing
View Details