Human MICA protein
This Human MICA protein spans the amino acid sequence from region 24-308aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1
Expression Region
24-308aa
Tag
C-terminal Fc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml.
Form
Lyophilized powder
Molecular Weight
59.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
AA Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
348791 1 Kit
Genesig Real-Time PCR detection kit for Bacillus cereus E33, Standard discontinued
Sign In for Pricing
View Details 
MBS1292839-01 0.02 mg (E-Coli)
Recombinant Oncorhynchus mykiss Pituitary-specific positive transcription factor 1 (pou1f1)
Sign In for Pricing
View Details MBS1292839-02 0.02 mg (Yeast)
Recombinant Oncorhynchus mykiss Pituitary-specific positive transcription factor 1 (pou1f1)
Sign In for Pricing
View Details