Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf9 protein

This Mouse Fgf9 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 9; FGF-9; Glia-activating factor; GAF; heparin-binding growth factor-9; HBGF-9; Fgf9; Fgf-9

UniProt

P54130

Expression Region

1-208aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 4.14 ng/ml.

Form

Liquid

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5

AA Sequence

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab 21 CRISPR/Cas9 KO Plasmid (h)
sc-406103 20 µg

Rab 21 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human EFR3A Protein
E30P9072 20 µg

Recombinant Human EFR3A Protein

Sign In for Pricing
View Details
Vmn1r86 3'UTR GFP Stable Cell Line
TU171975 1.0 mL

Vmn1r86 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Me-Tet-PEG4-NH2 (hydrochloride)
HY-133505-01 25 mg

Me-Tet-PEG4-NH2 (hydrochloride)

Sign In for Pricing
View Details
Me-Tet-PEG4-NH2 (hydrochloride)
HY-133505-02 50 mg

Me-Tet-PEG4-NH2 (hydrochloride)

Sign In for Pricing
View Details
Human Actin-Related Protein 10 (ACTR10) ELISA Kit
abx385605-01 96 Tests

Human Actin-Related Protein 10 (ACTR10) ELISA Kit

Sign In for Pricing
View Details