Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASEK protein

This Human RNASEK protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNase K (RNase kappa)

UniProt

Q6P5S7

Expression Region

1-137aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGWLRPGPRPLCPPARASWAFSHRFPSPLAPRRSPTPFFMASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cochliomycin B
HY-N16055 1 Each

Cochliomycin B

Sign In for Pricing
View Details
PD 198306
HY-107620-01 5 mg

PD 198306

Sign In for Pricing
View Details
PD 198306
HY-107620-02 10 mM - 1 mL

PD 198306

Sign In for Pricing
View Details
PD 198306
HY-107620-03 10 mg

PD 198306

Sign In for Pricing
View Details
PD 198306
HY-107620-04 25 mg

PD 198306

Sign In for Pricing
View Details
PD 198306
HY-107620-05 50 mg

PD 198306

Sign In for Pricing
View Details