Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm10922 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3763308 1.0 µg DNA

Gm10922 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ZFYVE19 antibody
FNab09629 100 µg

ZFYVE19 antibody

Sign In for Pricing
View Details
Skint1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6496006 1.0 µg DNA

Skint1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Cebpe sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4121708 1.0 µg DNA

Cebpe sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
MYADM Mouse Monoclonal Antibody [Clone ID: BM-5]
AM32298PU-N 100 µg

MYADM Mouse Monoclonal Antibody [Clone ID: BM-5]

Sign In for Pricing
View Details
MPRIP siRNA (Mouse)
CRM4820-01 15 nmol

MPRIP siRNA (Mouse)

Sign In for Pricing
View Details