Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc7a15 (NM_001106714) Rat Untagged Clone
RN205297 10 µg

Slc7a15 (NM_001106714) Rat Untagged Clone

Sign In for Pricing
View Details
HSPB Associated Protein 1 Protein
abx263199-01 1 µg

HSPB Associated Protein 1 Protein

Sign In for Pricing
View Details
HSPB Associated Protein 1 Protein
abx263199-02 5 µg

HSPB Associated Protein 1 Protein

Sign In for Pricing
View Details
HSPB Associated Protein 1 Protein
abx263199-03 50 µg

HSPB Associated Protein 1 Protein

Sign In for Pricing
View Details
Thiopurine S-methyltransferase (TPMT) Horse ELISA Kit
H5690 96 Tests

Thiopurine S-methyltransferase (TPMT) Horse ELISA Kit

Sign In for Pricing
View Details
N-Ethyl 4-fluorobenzenesulfonamide
458939-01 100 mg

N-Ethyl 4-fluorobenzenesulfonamide

Sign In for Pricing
View Details