Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal p53 Antibody (rTP53/8579) [Alexa Fluor 350]
NBP3-21043AF350 0.1 mL

Mouse Monoclonal p53 Antibody (rTP53/8579) [Alexa Fluor 350]

Sign In for Pricing
View Details
Phospho-Smad2 (Ser250) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-7464R-BF555 100 µL

Phospho-Smad2 (Ser250) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
SHMT1 Human
OM299719-01 20 µg

SHMT1 Human

Sign In for Pricing
View Details
SHMT1 Human
OM299719-02 5 µg

SHMT1 Human

Sign In for Pricing
View Details
SHMT1 Human
OM299719-03 1 mg

SHMT1 Human

Sign In for Pricing
View Details
Mouse Toll Like Receptor 3 (TLR3) ELISA Kit
MBS2704018-01 24 Strip Well

Mouse Toll Like Receptor 3 (TLR3) ELISA Kit

Sign In for Pricing
View Details