Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Icam1 (NM_010493) Mouse Tagged ORF Clone Lentiviral Particle
MR227081L3V 200 µL

Icam1 (NM_010493) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SPG21 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
45290066 1.0 µg DNA

SPG21 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZHX3 Antibody (C-term)
MBS9210063-01 0.08 mL

ZHX3 Antibody (C-term)

Sign In for Pricing
View Details
ZHX3 Antibody (C-term)
MBS9210063-02 0.4 mL

ZHX3 Antibody (C-term)

Sign In for Pricing
View Details
ZHX3 Antibody (C-term)
MBS9210063-03 5x 0.4 mL

ZHX3 Antibody (C-term)

Sign In for Pricing
View Details
Human MARS1 Pre-designed siRNA Set A
SI009274A 1 Each

Human MARS1 Pre-designed siRNA Set A

Sign In for Pricing
View Details