Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SARS-CoV-2 Antibody IgG Quantitative and Titer Detection Kit (Spike RBD)
RAS-T093 96 Tests

Anti-SARS-CoV-2 Antibody IgG Quantitative and Titer Detection Kit (Spike RBD)

Sign In for Pricing
View Details
GFP hsa-miR-548ao-3p AAV miRNA Vector
Amh1217400 500 ng

GFP hsa-miR-548ao-3p AAV miRNA Vector

Sign In for Pricing
View Details
Human BBS7 Recombinant Protein
PPT-10802 100 µg

Human BBS7 Recombinant Protein

Sign In for Pricing
View Details
LOC688553 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7506108 1.0 µg DNA

LOC688553 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Leuconostoc mesenteroides subsp. mesenteroides Protease HtpX homolog (htpX), partial
MBS7058924 Inquire

Recombinant Leuconostoc mesenteroides subsp. mesenteroides Protease HtpX homolog (htpX), partial

Sign In for Pricing
View Details
Mouse anti Human IgG
40R-1003 100 ug

Mouse anti Human IgG

Sign In for Pricing
View Details