What is the catalog number for Rabbit TFPI protein?

The catalog number for Rabbit TFPI protein is orb605252.

What sizes are available for Rabbit TFPI protein?

Rabbit TFPI protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Rabbit TFPI protein come in?

Rabbit TFPI protein is available in 3 different pack sizes.

Is Rabbit TFPI protein in stock?

Rabbit TFPI protein is currently made to order / not held in immediate stock. Contact us for lead time.

Rabbit TFPI protein

This Rabbit TFPI protein spans the amino acid sequence from region 25-300aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)

UniProt

P19761

Expression Region

25-300aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.

Form

Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT