Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPB protein

This Human SFTPB protein spans the amino acid sequence from region 201-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18 kDa pulmonary-surfactant protein 6 kDa protein Pulmonary surfactant-associated proteolipid SPL (Phe)

UniProt

P07988

Expression Region

201-279aa

Tag

N-terminal MBP-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ECM2 Knockout A549 cell line
GTR15413133 1 Vial

Human ECM2 Knockout A549 cell line

Sign In for Pricing
View Details
SESN1 Antibody, Biotin conjugated
CSB-PA021095LD01HU-01 50 µg

SESN1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SESN1 Antibody, Biotin conjugated
CSB-PA021095LD01HU-02 100 µg

SESN1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Oct-1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-63240R-BF680 100 µL

Oct-1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
NBL1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-6043R-PerCP-Cy5.5 100 µL

NBL1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
PHB2 Antibody
30-396 100 µL

PHB2 Antibody

Sign In for Pricing
View Details