Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRY2 protein

This Human CRY2 protein spans the amino acid sequence from region 1-593aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA0658

UniProt

Q49AN0

Expression Region

1-593aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

74.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: LBI4H7]
AMM21066VCF 100 µg

Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: LBI4H7]

Sign In for Pricing
View Details
GPR162 Lentiviral Activation Particles (h2)
sc-411982-LAC-2 200 µL

GPR162 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Cadherin E, Recombinant, Human (Cadherin 1, E-Cadherin, L-CAM, Epithelial Cell Adhesion Molecule, Uvomorulin, CDH1) discontinued. see 153755
C0108-25T-01 2 µg

Cadherin E, Recombinant, Human (Cadherin 1, E-Cadherin, L-CAM, Epithelial Cell Adhesion Molecule, Uvomorulin, CDH1) discontinued. see 153755

Sign In for Pricing
View Details
Cadherin E, Recombinant, Human (Cadherin 1, E-Cadherin, L-CAM, Epithelial Cell Adhesion Molecule, Uvomorulin, CDH1) discontinued. see 153755
C0108-25T-02 5 µg

Cadherin E, Recombinant, Human (Cadherin 1, E-Cadherin, L-CAM, Epithelial Cell Adhesion Molecule, Uvomorulin, CDH1) discontinued. see 153755

Sign In for Pricing
View Details
Radil (NM_001037218) Rat Tagged ORF Clone Lentiviral Particle
RR213686L3V 200 µL

Radil (NM_001037218) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Xenopus laevis Tetratricopeptide repeat protein 35-B (ttc35-b)
MBS1425575-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Tetratricopeptide repeat protein 35-B (ttc35-b)

Sign In for Pricing
View Details