Fish X Outer capsid protein VP4 protein
This Fish X Outer capsid protein VP4 protein spans the amino acid sequence from region 36-214aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Equinatoxin II (DELTA-AITX-Aeq1a) (EqT II) (EqTII) (Equinatoxin-2)
UniProt
P61914
Expression Region
36-214aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Actinia equina (Beadlet anemone)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SADVAGAVIDGASLSFDILKTVLEALGNVKRKIAVGVDNESGKTWTALNTYFRSGTSDIVLPHKVPHGKALLYNGQKDRGPVATGAVGVLAYLMSDGNTLAVLFSVPYDYNWYSNWWNVRIYKGKRRADQRMYEELYYNLSPFRGDNGWHTRNLGYGLKSRGFMNSSGHAILEIHVSKA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403186-100 1x 100 µL
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (rS100A4/1481), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9]](https://cdn.genprice.uk/products/937/68dd1b68061270361ea153a9/imageurl/ta502045am.webp)
TA502045AM 100 µL
Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9]
Sign In for Pricing
View Details 
BNC682550-500 1x 500 µL
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details